Structure of PDB 3hqr Chain A Binding Site BS01

Receptor Information
>3hqr Chain A (length=225) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QTKPLPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTG
KFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHC
NGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKD
WDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATR
YAITVWYFDADERAAAKVKYLTGEK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3hqr Structural basis for binding of hypoxia-inducible factor to the oxygen-sensing prolyl hydroxylases
Resolution2.0 Å
Binding residue
(original residue number in PDB)		Q239 L240 V241 S242 K244 I251 R252 W258 N293 G294 R295 K297 Y310 H313 V314 D315 P317 R322 R370 W389 Y390 F391 R396 K400 Y403
Binding residue
(residue number reindexed from 1)		Q56 L57 V58 S59 K61 I68 R69 W75 N110 G111 R112 K114 Y127 H130 V131 D132 P134 R139 R187 W206 Y207 F208 R213 K217 Y220
Enzymatic activity
Enzyme Commision number 1.14.11.29: hypoxia-inducible factor-proline dioxygenase.
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0031418 L-ascorbic acid binding

View graph for
Molecular Function
External links
PDB RCSB:3hqr, PDBe:3hqr, PDBj:3hqr
PDBsum3hqr
PubMed19604478
UniProtQ9GZT9|EGLN1_HUMAN Egl nine homolog 1 (Gene Name=EGLN1)

[Back to BioLiP]