Structure of PDB 3hql Chain A Binding Site BS01

Receptor Information
>3hql Chain A (length=134) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KVVKFSYMWTINNFSFCREEMGEVIKSSTFSSDKLKWCLRVNPKGLDEES
KDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKD
WGFKKFIRRGFLLDEANGLLPDDKLTLFCEVSVV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3hql Structures of SPOP-substrate complexes: insights into molecular architectures of BTB-Cul3 ubiquitin ligases.
Resolution1.66 Å
Binding residue
(original residue number in PDB)
R70 Y87 M117 Y123 K129 D130 W131 G132 F133
Binding residue
(residue number reindexed from 1)
R40 Y57 M87 Y93 K99 D100 W101 G102 F103
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3hql, PDBe:3hql, PDBj:3hql
PDBsum3hql
PubMed19818708
UniProtO43791|SPOP_HUMAN Speckle-type POZ protein (Gene Name=SPOP)

[Back to BioLiP]