Structure of PDB 3hdb Chain A Binding Site BS01

Receptor Information
>3hdb Chain A (length=417) Species: 36307 (Deinagkistrodon acutus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YDPFKYVETVFVVDKAMVTKYNGDLDKIKTKMYEAANNMNEMYRYMFFRV
VMVGLIIWTEEDKITVKPDVDYTLNAFAEWRKTYLLAEKKHDNAQLITGI
DFRGSIIGYAYIGSMCHPKRSVGIIQDYSPINLVLAVIMAHEMGHNLGIH
HDDGYCYCGGYPCIMGPSISPEPSKFFSNCSYIQCWDFIMNHNPECIDNE
PLGTDIISPPLCGNELLEVGEECDCGTPENCQNPCCDAATCKLKSGSQCG
HGKCCEQCKFRTSGTECRASMSECDPAEHCTGQSSECPADVFHKNGEPCL
DNYGYCYNGNCPIMYHQCYALFGADIYEAEDSCFESNKKGNYYGYCRKEN
GKKIPCASEDVKCGRLYCKDDSPGQNNPCKMFYSNDDEHKGMVLPGTKCA
DGKVCSNGHCVDVTTAY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3hdb Structural basis of the autolysis of AaHIV suggests a novel target recognizing model for ADAM/reprolysin family proteins
Resolution2.31 Å
Binding residue
(original residue number in PDB)
S297 I298 I299 G300 Y320 I330 H333 E334 H343 P359 S360 I361
Binding residue
(residue number reindexed from 1)
S105 I106 I107 G108 Y128 I138 H141 E142 H151 P167 S168 I169
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Wed Feb 19 00:49:46 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '3hdb', asym_id = 'A', bs = 'BS01', title = 'Structural basis of the autolysis of AaHIV sugge...gnizing model for ADAM/reprolysin family proteins'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='3hdb', asym_id='A', bs='BS01', title='Structural basis of the autolysis of AaHIV sugge...gnizing model for ADAM/reprolysin family proteins')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0004222,0006508,0008237', uniprot = '', pdbid = '3hdb', asym_id = 'A'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004222,0006508,0008237', uniprot='', pdbid='3hdb', asym_id='A')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>