Structure of PDB 3hc6 Chain A Binding Site BS01

Receptor Information

>3hc6 Chain A (length=230) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

TELTPDQQTLLHFIMDSYNKQRMPQEITNKILKEEFSAEENFLILTEMAT
NHVQVLVEFTKKLPGFQTLDHEDQIALLKGSAVEAMFLRSAEIFNKKLPS
GHSDLLEERIRNSGISDEYITPMFSFYKSIGELKMTQEEYALLTAIVILS
PDRQYIKDREAVEKLQEPLLDVLQKLCKIHQPENPQHFAELLGRLTELRT
FNHHHAEMLMSWRVNDHKFTPLLEEIWDVQ

Ligand information

>3hc6 Chain B (length=11) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

DHQLLRYLLDK

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3hc6 FXR agonist activity of conformationally constrained analogs of GW 4064.
Resolution	3.2 Å
Binding residue (original residue number in PDB)	P463 L464 E467
Binding residue (residue number reindexed from 1)	P221 L222 E225

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0004879	nuclear receptor activity
GO:0032052	bile acid binding
GO:0035100	ecdysone binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription
GO:0035076	ecdysone receptor signaling pathway
GO:0038183	bile acid signaling pathway

	Cellular Component
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3hc6, PDBe:3hc6, PDBj:3hc6
PDBsum	3hc6
PubMed	19586769
UniProt	Q96RI1\|NR1H4_HUMAN Bile acid receptor (Gene Name=NR1H4)

[Back to BioLiP]