Structure of PDB 3h25 Chain A Binding Site BS01

Receptor Information
>3h25 Chain A (length=188) Species: 2504 (Plasmid RSF1010) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DRTLQAIGRQLKAMGCERFDIGVRDATTGQMMNREWSAAEVLQNTPWLKR
MNAQGNDVYIRPAEQERHGLVLVDDLSEFDLDDMKAEGREPALVVETSPK
NYQAWVKVADAAGGELRGQIARTLASEYDADPASADSRHYGRLAGFTNRK
DKQPWVLLRESKGKTATAGPALVQQAGQQIEQAQRQQE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3h25 Structure and function of primase RepB' encoded by broad-host-range plasmid RSF1010 that replicates exclusively in leading-strand mode
Resolution2.7 Å
Binding residue
(original residue number in PDB)		R5 T6 M35 R37 P49 W50 K52 R53 N55 A56 G148 T150 Q163 W165 L167 L168
Binding residue
(residue number reindexed from 1)		R2 T3 M32 R34 P46 W47 K49 R50 N52 A53 G145 T147 Q153 W155 L157 L158
Enzymatic activity
Enzyme Commision number ?
External links