Structure of PDB 3h1z Chain A Binding Site BS01

Receptor Information
>3h1z Chain A (length=233) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GGYVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFA
IQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQ
VAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQI
KECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELR
IQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3h1z Molecular basis for association of PIPKI gamma-p90 with clathrin adaptor AP-2.
Resolution1.83 Å
Binding residue
(original residue number in PDB)		F753 A754 I755 Q756 N758 T768 P769 L770 H773 Q804 A806 K808 Y815
Binding residue
(residue number reindexed from 1)		F49 A50 I51 Q52 N54 T64 P65 L66 H69 Q100 A102 K104 Y111
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006886 intracellular protein transport
GO:0016192 vesicle-mediated transport
Cellular Component
GO:0030117 membrane coat
GO:0030131 clathrin adaptor complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3h1z, PDBe:3h1z, PDBj:3h1z
PDBsum3h1z
PubMed19903820
UniProtP62944|AP2B1_RAT AP-2 complex subunit beta (Gene Name=Ap2b1)

[Back to BioLiP]