Structure of PDB 3gz1 Chain A Binding Site BS01

Receptor Information
>3gz1 Chain A (length=144) Species: 623 (Shigella flexneri) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NESISTAVIDAINSGATLKDINAIPDDMMDDIYSYAYDFYNKGRIEEAEV
FFRFLCIYDFYNVDYIMGLAAIYQIKEQFQQAADLYAVAFALGKNDYTPV
FHTGQCQLRLKAPLKAKECFELVIQHSNDEKLKIKAQSYLDAIQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3gz1 IpaB-IpgC interaction defines binding motif for type III secretion translocator
Resolution2.15 Å
Binding residue
(original residue number in PDB)		D37 Y40 Y44 Y47 D71 A78 Q81
Binding residue
(residue number reindexed from 1)		D30 Y33 Y37 Y40 D64 A71 Q74
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0042802 identical protein binding
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:3gz1, PDBe:3gz1, PDBj:3gz1
PDBsum3gz1
PubMed19478065
UniProtP0A2U4|IPGC_SHIFL Chaperone protein IpgC (Gene Name=ipgC)

[Back to BioLiP]