Structure of PDB 3gyt Chain A Binding Site BS01

Receptor Information
>3gyt Chain A (length=242) Species: 6248 (Strongyloides stercoralis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YTLSEKDLKELDSIRDSFQCMNEPLDNDQQASTLAKKEHNPTDILNVMDI
TMRRLVKMAKRLGAFNEISEAGKFSLLKGGMIEMLTIRGVTVFNADKGVW
QTPVDGHSQISFNMFDKLRPDIKDTQKKGFLHFFNLLHSDVRKNDLAIDI
IVLMVLFDSKREGLVSQQDKETVEKLHRNYESLLHRYLYSIHKEEAEQRF
ASIPKALVALRKVAENAVTLFLGAGNTTEAASLPKEFFATNY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3gyt Identification of the nuclear receptor DAF-12 as a therapeutic target in parasitic nematodes.
Resolution2.4 Å
Binding residue
(original residue number in PDB)
K571 F585 K589 S743 E747
Binding residue
(residue number reindexed from 1)
K60 F74 K78 S232 E236
Enzymatic activity
Enzyme Commision number ?
External links