Structure of PDB 3gxv Chain A Binding Site BS01

Receptor Information
>3gxv Chain A (length=122) Species: 210 (Helicobacter pylori) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDHLKHLQQLQNIERIVLSGIVLANHKIEEVHSVLEPSDFYYPPNGLFFE
IALKLHEEDCPIDENFIRQKMPKDKQIKEEDLVAIFAASPIDNIEAYVEE
IKNASIKRKLFGLANTIREQAH
Ligand information
>3gxv Chain C (length=22) Species: 210 (Helicobacter pylori) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
IKNASIKRKLFGLANTIREQAL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3gxv Three-dimensional structure of N-terminal domain of DnaB helicase and helicase-primase interactions in Helicobacter pylori
Resolution2.2 Å
Binding residue
(original residue number in PDB)		N103 I106 L110 L113
Binding residue
(residue number reindexed from 1)		N103 I106 L110 L113
Enzymatic activity
Enzyme Commision number 3.6.4.12: DNA helicase.
Gene Ontology
Molecular Function
GO:0003678 DNA helicase activity
GO:0005524 ATP binding
Biological Process
GO:0006260 DNA replication

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3gxv, PDBe:3gxv, PDBj:3gxv
PDBsum3gxv
PubMed19841750
UniProtO25916|DNAB_HELPY Replicative DNA helicase DnaB (Gene Name=dnaB)

[Back to BioLiP]