Structure of PDB 3gxe Chain A Binding Site BS01

Receptor Information
>3gxe Chain A (length=87) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DQCIVDDITYNVQDTFHKKHEEGHMLNCTCFGQGRGRWKCDPVDQCQDSE
TGTFYQIGDSWEKYVHGVRYQCYCYGRGIGEWHCQPL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3gxe Structural analysis of collagen type I interactions with human fibronectin reveals a cooperative binding mode
Resolution2.6 Å
Binding residue
(original residue number in PDB)		D516 K533 H535 H539 L541 G549 R550 G551 R552 W553 K554 C555 P557 Q560 F569 H598
Binding residue
(residue number reindexed from 1)		D1 K18 H20 H24 L26 G34 R35 G36 R37 W38 K39 C40 P42 Q45 F54 H83
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005576 extracellular region

View graph for
Cellular Component
External links
PDB RCSB:3gxe, PDBe:3gxe, PDBj:3gxe
PDBsum3gxe
PubMed23653354
UniProtP02751|FINC_HUMAN Fibronectin (Gene Name=FN1)

[Back to BioLiP]