Structure of PDB 3gv6 Chain A Binding Site BS01

Receptor Information
>3gv6 Chain A (length=56) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ERVFAAESIIKRRIRKGRIEYLVKWKGWAIKYSTWEPEENILDSRLIAAF
EQKERE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3gv6 Recognition and specificity determinants of the human cbx chromodomains.
Resolution1.76 Å
Binding residue
(original residue number in PDB)		E8 R9 V10 F11 A12 A13 E14 W32 W35 E43 N47 L49 D50 R52
Binding residue
(residue number reindexed from 1)		E1 R2 V3 F4 A5 A6 E7 W25 W28 E36 N40 L42 D43 R45
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3gv6, PDBe:3gv6, PDBj:3gv6
PDBsum3gv6
PubMed21047797
UniProtO95503|CBX6_HUMAN Chromobox protein homolog 6 (Gene Name=CBX6)

[Back to BioLiP]