Structure of PDB 3gv4 Chain A Binding Site BS01

Receptor Information
>3gv4 Chain A (length=99) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PLPWCPHLVAVCPIPAAGLDVTQPCGDCGTIQENWVCLSCYQVYCGRYIN
GHMLQHHGNSGHPLVLSYIDLSAWCYYCQAYVHHQALLDVKNIAHQNKF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3gv4 Crystal structure of human HDAC6 zinc finger domain and ubiquitin C-terminal peptide RLRGG
Resolution1.72 Å
Binding residue
(original residue number in PDB)		W35 G46 R47 Y48 W74 Y76 Y81
Binding residue
(residue number reindexed from 1)		W35 G46 R47 Y48 W74 Y76 Y81
Enzymatic activity
Enzyme Commision number 3.5.1.-
3.5.1.98: histone deacetylase.
Gene Ontology
Molecular Function
GO:0008270 zinc ion binding

View graph for
Molecular Function
External links
PDB RCSB:3gv4, PDBe:3gv4, PDBj:3gv4
PDBsum3gv4
PubMed
UniProtQ9UBN7|HDAC6_HUMAN Histone deacetylase 6 (Gene Name=HDAC6)

[Back to BioLiP]