Structure of PDB 3gut Chain A Binding Site BS01

Receptor Information

>3gut Chain A (length=273) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

AYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTG
PGTVRISLVTKDPPHRPHPHELVGKDCRDGYYEADLCPDRSIHSFQNLGI
QCVKKRDLEQAISQRIQTNNNPFHVPIEEQRGDYDLNAVRLCFQVTVRDP
AGRPLLLTPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDK
VQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRV
SMQLRRPSDRELSEPMEFQYLPD

Ligand information

>3gut Chain X (length=26) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

agggactttccgctggggactttcca

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3gut Structural basis of HIV-1 activation by NF-kappaB--a higher-order complex of p50:RelA bound to the HIV-1 LTR.
Resolution	3.59 Å
Binding residue (original residue number in PDB)	Y36 C38 E39 K122 R187
Binding residue (residue number reindexed from 1)	Y18 C20 E21 K104 R169
Binding affinity	PDBbind-CN: Kd=1.5nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3gut, PDBe:3gut, PDBj:3gut
PDBsum	3gut
PubMed	19683540
UniProt	Q04206\|TF65_HUMAN Transcription factor p65 (Gene Name=RELA)

[Back to BioLiP]