Structure of PDB 3gs2 Chain A Binding Site BS01

Receptor Information
>3gs2 Chain A (length=109) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASEIELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEEL
RSKGESNQMNLDTEKQYTIYIATASGQFTVLDGSFSLELVSEKYWKVNKP
MELYYAPTK
Ligand information
>3gs2 Chain D (length=29) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EVTVTDITANSITVTFREAQAAEGFFRDR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3gs2 Polycomb Group Targeting through Different Binding Partners of RING1B C-Terminal Domain.
Resolution1.699 Å
Binding residue
(original residue number in PDB)		G276 E277 S278 N279
Binding residue
(residue number reindexed from 1)		G54 E55 S56 N57
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Gene Ontology
Cellular Component
GO:0000151 ubiquitin ligase complex

View graph for
Cellular Component
External links
PDB RCSB:3gs2, PDBe:3gs2, PDBj:3gs2
PDBsum3gs2
PubMed20696397
UniProtQ99496|RING2_HUMAN E3 ubiquitin-protein ligase RING2 (Gene Name=RNF2)

[Back to BioLiP]