Structure of PDB 3gq1 Chain A Binding Site BS01

Receptor Information
>3gq1 Chain A (length=85) Species: 155892 (Caulobacter vibrioides) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TQKPSLYRVLILNDDYTPMEFVVYVLERFFNKSREDATRIMLHVHQNGVG
VCGVYTYEVAETKVAQVIDSARRHQHPLQCTMEKD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3gq1 Molecular basis of substrate selection by the N-end rule adaptor protein ClpS.
Resolution1.496 Å
Binding residue
(original residue number in PDB)		L46 N47 D48 T51 P52 M53 V56 M75 V78 H79 L112
Binding residue
(residue number reindexed from 1)		L12 N13 D14 T17 P18 M19 V22 M41 V44 H45 L78
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006508 proteolysis
GO:0030163 protein catabolic process

View graph for
Biological Process
External links
PDB RCSB:3gq1, PDBe:3gq1, PDBj:3gq1
PDBsum3gq1
PubMed19451643
UniProtQ9A5I0|CLPS_CAUVC ATP-dependent Clp protease adapter protein ClpS (Gene Name=clpS)

[Back to BioLiP]