Structure of PDB 3gnb Chain A Binding Site BS01

Receptor Information
>3gnb Chain A (length=68) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GGRPRQHLLSLTRRAQKHRLRELKIQVKEFADKEEGGDVKAVCLTLFLLA
LRARNEHRQADELEAIMQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3gnb Structure of the RAG1 nonamer binding domain with DNA reveals a dimer that mediates DNA synapsis.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		G390 R391 P392 K405 R409
Binding residue
(residue number reindexed from 1)		G2 R3 P4 K17 R21
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
GO:0043565 sequence-specific DNA binding
GO:0061630 ubiquitin protein ligase activity
Biological Process
GO:0033151 V(D)J recombination

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3gnb, PDBe:3gnb, PDBj:3gnb
PDBsum3gnb
PubMed19396172
UniProtP15919|RAG1_MOUSE V(D)J recombination-activating protein 1 (Gene Name=Rag1)

[Back to BioLiP]