Structure of PDB 3gna Chain A Binding Site BS01

Receptor Information
>3gna Chain A (length=68) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GGRPRQHLLSLTRRAQKHRLRELKIQVKEFADKEEGGDVKAVCLTLFLLA
LRARNEHRQADELEAIMQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3gna Structure of the RAG1 nonamer binding domain with DNA reveals a dimer that mediates DNA synapsis.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		G389 G390 R391 P392 K405 K412
Binding residue
(residue number reindexed from 1)		G1 G2 R3 P4 K17 K24
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
GO:0043565 sequence-specific DNA binding
GO:0061630 ubiquitin protein ligase activity
Biological Process
GO:0033151 V(D)J recombination

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3gna, PDBe:3gna, PDBj:3gna
PDBsum3gna
PubMed19396172
UniProtP15919|RAG1_MOUSE V(D)J recombination-activating protein 1 (Gene Name=Rag1)

[Back to BioLiP]