Structure of PDB 3gm1 Chain A Binding Site BS01

Receptor Information
>3gm1 Chain A (length=140) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PTANLDRTDDLVYLNVMELVRAVLELKNELAQLPPEGYVVVVKNVGLTLR
KLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLAQQNAVTSL
SEECKRQMLTASHTLAVDAKNLLDAVDQAKVLANLAHPPA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3gm1 Crystal structures of free and ligand-bound focal adhesion targeting domain of Pyk2
Resolution2.95 Å
Binding residue
(original residue number in PDB)		P869 T870 N872 Y881 M885 L892 K988
Binding residue
(residue number reindexed from 1)		P1 T2 N4 Y13 M17 L24 K120
Enzymatic activity
Enzyme Commision number 2.7.10.2: non-specific protein-tyrosine kinase.
Gene Ontology
Molecular Function
GO:0004713 protein tyrosine kinase activity
Biological Process
GO:0006468 protein phosphorylation
GO:0007172 signal complex assembly
Cellular Component
GO:0005925 focal adhesion

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3gm1, PDBe:3gm1, PDBj:3gm1
PDBsum3gm1
PubMed19358827
UniProtQ14289|FAK2_HUMAN Protein-tyrosine kinase 2-beta (Gene Name=PTK2B)

[Back to BioLiP]