Structure of PDB 3glr Chain A Binding Site BS01

Receptor Information

>3glr Chain A (length=274) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQ
YDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKG
LLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRA
DVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGT
SLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGV
ESLVELLGWTEEMRDLVQRETGKL

Ligand information

>3glr Chain B (length=7) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

RSGKVMR

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3glr Crystal Structures of Human SIRT3 Displaying Substrate-induced Conformational Changes.
Resolution	1.8 Å
Binding residue (original residue number in PDB)	H248 V292 F294 G295 E296 P297 E323 V324 E325 W353
Binding residue (residue number reindexed from 1)	H128 V172 F174 G175 E176 P177 E203 V204 E205 W233

Enzymatic activity

Catalytic site (original residue number in PDB)	P155 D156 F157 R158 N229 D231 H248
Catalytic site (residue number reindexed from 1)	P35 D36 F37 R38 N109 D111 H128
Enzyme Commision number	2.3.1.286: protein acetyllysine N-acetyltransferase.

Gene Ontology

	Molecular Function
GO:0017136	NAD-dependent histone deacetylase activity
GO:0051287	NAD binding
GO:0070403	NAD+ binding

View graph for
Molecular Function

External links

PDB	RCSB:3glr, PDBe:3glr, PDBj:3glr
PDBsum	3glr
PubMed	19535340
UniProt	Q9NTG7\|SIR3_HUMAN NAD-dependent protein deacetylase sirtuin-3, mitochondrial (Gene Name=SIRT3)

[Back to BioLiP]