Structure of PDB 3gl6 Chain A Binding Site BS01

Receptor Information
>3gl6 Chain A (length=52) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SVCAAQNCQRPCKDKVDWVQCDGGCDEWFHQVCVGVSPEMAENEDYICIN
CA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3gl6 Haematopoietic malignancies caused by dysregulation of a chromatin-binding PHD finger.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		D1621 K1622 V1623 D1624 W1625 V1626 Q1627 D1633 W1635 A1648 E1649 E1651
Binding residue
(residue number reindexed from 1)		D14 K15 V16 D17 W18 V19 Q20 D26 W28 A41 E42 E44
Enzymatic activity
Enzyme Commision number 1.14.11.67: [histone H3]-trimethyl-L-lysine(4) demethylase.
External links
PDB RCSB:3gl6, PDBe:3gl6, PDBj:3gl6
PDBsum3gl6
PubMed19430464
UniProtP29375|KDM5A_HUMAN Lysine-specific demethylase 5A (Gene Name=KDM5A)

[Back to BioLiP]