Structure of PDB 3ggz Chain A Binding Site BS01

Receptor Information
>3ggz Chain A (length=186) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PSMIPFTIKLKTCLKMCIQRLRYAQEKQQAIAKQSRRQVAQLLLTNKEQK
AHYRVETLIHDDIHIELLEILELYCELLLARVQVINDISTEEQLVKEHMD
DGINEAIRSLIYAILFVDEVKELSQLKDLMAWKINVEFVNGVIADHIDVP
EKIIKKCSPSVPKEELVDLYLKEIAKTYDVPYSKLE
Ligand information
>3ggz Chain E (length=17) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DDEKEDKLAQRLRALRG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3ggz Structural basis of Ist1 function and Ist1-Did2 interaction in the multivesicular body pathway and cytokinesis.
Resolution3.8 Å
Binding residue
(original residue number in PDB)		K35 E68 L171 Y172 T179
Binding residue
(residue number reindexed from 1)		K33 E66 L169 Y170 T177
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0015031 protein transport

View graph for
Biological Process
External links
PDB RCSB:3ggz, PDBe:3ggz, PDBj:3ggz
PDBsum3ggz
PubMed19477918
UniProtP53843|IST1_YEAST Vacuolar protein sorting-associated protein IST1 (Gene Name=IST1)

[Back to BioLiP]