Structure of PDB 3geg Chain A Binding Site BS01

Receptor Information

>3geg Chain A (length=241) Species: 203119 (Acetivibrio thermocellus ATCC 27405)

NRGVIVTGGGHGIGKQICLDFLEAGDKVCFIDIDEKRSADFAKERPNLFY
FHGDVADPLTLKKFVEYAMEKLQRIDVLVNNACRGSKGILSSLLYEEFDY
ILSVGLKAPYELSRLCRDELIKNKGRIINIASTRAFQSEPDSEAYASAKG
GIVALTHALAMSLGPDVLVNCIAPGWINVTFTQEDCAAIPAGKVGTPKDI
SNMVLFLCQQDFITGETIIVDGGMSKRMIYHGDWNWFYKID

Ligand information

• Ligand ID: NAD
• InChI: InChI=1S/C21H27N7O14P2/c22-17-12-19(25-7-24-17)28(8-26-12)21-16(32)14(30)11(41-21)6-39-44(36,37)42-43(34,35)38-5-10-13(29)15(31)20(40-10)27-3-1-2-9(4-27)18(23)33/h1-4,7-8,10-11,13-16,20-21,29-32H,5-6H2,(H5-,22,23,24,25,33,34,35,36,37)/t10-,11-,13-,14-,15-,16-,20-,21-/m1/s1
• InChIKey: BAWFJGJZGIEFAR-NNYOXOHSSA-N
• SMILES:
  CACTVS 3.341: NC(=O)c1ccc[n+](c1)[C@@H]2O[C@H](CO[P]([O-])(=O)O[P@](O)(=O)OC[C@H]3O[C@H]([C@H](O)[C@@H]3O)n4cnc5c(N)ncnc45)[C@@H](O)[C@H]2O
  OpenEye OEToolkits 1.5.0: c1cc(c[n+](c1)C2C(C(C(O2)COP(=O)([O-])OP(=O)(O)OCC3C(C(C(O3)n4cnc5c4ncnc5N)O)O)O)O)C(=O)N
  CACTVS 3.341: NC(=O)c1ccc[n+](c1)[CH]2O[CH](CO[P]([O-])(=O)O[P](O)(=O)OC[CH]3O[CH]([CH](O)[CH]3O)n4cnc5c(N)ncnc45)[CH](O)[CH]2O
  OpenEye OEToolkits 1.5.0: c1cc(c[n+](c1)[C@H]2[C@@H]([C@@H]([C@H](O2)CO[P@@](=O)([O-])O[P@@](=O)(O)OC[C@@H]3[C@H]([C@H]([C@@H](O3)n4cnc5c4ncnc5N)O)O)O)O)C(=O)N
• Formula: C21 H27 N7 O14 P2
• Name: NICOTINAMIDE-ADENINE-DINUCLEOTIDE
• ChEMBL: CHEMBL1234613
• DrugBank: DB14128
• PDB chain: 3geg Chain A Residue 248

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3geg Sequence fingerprint and structural analysis of the SCOR enzyme A3DFK9 from Clostridium thermocellum.
• Resolution: 2.102 Å
• Binding residue (original residue number in PDB): G9 H12 I14 D33 I34 R38 D55 V56 N82 C84 R85 I131 A132 S133 Y146 K150 P175 G176 I178 V180
• Binding residue (residue number reindexed from 1): G8 H11 I13 D32 I33 R37 D54 V55 N81 C83 R84 I130 A131 S132 Y145 K149 P174 G175 I177 V179
• Annotation score: 4

Enzymatic activity

• Catalytic site (original residue number in PDB): S133 Y146 K150
• Catalytic site (residue number reindexed from 1): S132 Y145 K149

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0016491 oxidoreductase activity
• GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor

External links

• PDB: RCSB:3geg, PDBe:3geg, PDBj:3geg
• PDBsum: 3geg
• PubMed: 19774618
• UniProt: A3DFK9