Structure of PDB 3gds Chain A Binding Site BS01

Receptor Information
>3gds Chain A (length=296) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DSTDETPASYNLAVRRAAPAVVNVYNRGLNTNSHNQLEIRTLGSGVIMDQ
RGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGG
LPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQ
NFLQTDASINPGNSGGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIP
FQLATKIMDKLIRDGRVIRGYIGIGGREQGIVVNEVSPDGPAANAGIQVN
DLIISVDNKPAISALETMAQVAEIRPGSVIPVVVTLQVTIQEYPAT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3gds OMP peptides activate the DegS stress-sensor protease by a relief of inhibition mechanism.
Resolution2.85 Å
Binding residue
(original residue number in PDB)		Y258 I259 G260 I261 G262 G263 L316 M319
Binding residue
(residue number reindexed from 1)		Y221 I222 G223 I224 G225 G226 L265 M268
Enzymatic activity
Enzyme Commision number 3.4.21.107: peptidase Do.
Gene Ontology
Molecular Function
GO:0004175 endopeptidase activity
GO:0004252 serine-type endopeptidase activity
GO:0005515 protein binding
GO:0008233 peptidase activity
GO:0008236 serine-type peptidase activity
GO:0042802 identical protein binding
Biological Process
GO:0006508 proteolysis
GO:0071218 cellular response to misfolded protein
Cellular Component
GO:0005886 plasma membrane
GO:0030288 outer membrane-bounded periplasmic space

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3gds, PDBe:3gds, PDBj:3gds
PDBsum3gds
PubMed19836340
UniProtP0AEE3|DEGS_ECOLI Serine endoprotease DegS (Gene Name=degS)

[Back to BioLiP]