Structure of PDB 3gd2 Chain A Binding Site BS01

Receptor Information
>3gd2 Chain A (length=227) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSTPDQQTLLHFIMDSYNKQRMPQEITNKILKEESAEENFLILTEMATNH
VQVLVEFTKKLPGFQTLDHEDQIALLKGSAVEAMFLRSAEIFNKLPSGHS
DLLEERIRNSGISDEYITPMFSFYKSIGELKMTQEEYALLTAIVILSPDR
QYIKDREAVEKLQEPLLDVLQKLCKIHQPENPQHFAELLGRLTELRTFNH
HHAEMLMSWRVNDHKFTPLLEEIWDVQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3gd2 Substituted isoxazole analogs of farnesoid X receptor (FXR) agonist GW4064.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		V299 H313 I317 K321 P463 L464 E467
Binding residue
(residue number reindexed from 1)		V55 H69 I73 K77 P218 L219 E222
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004879 nuclear receptor activity
GO:0032052 bile acid binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0038183 bile acid signaling pathway

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3gd2, PDBe:3gd2, PDBj:3gd2
PDBsum3gd2
PubMed19410460
UniProtQ96RI1|NR1H4_HUMAN Bile acid receptor (Gene Name=NR1H4)

[Back to BioLiP]