Structure of PDB 3ga6 Chain A Binding Site BS01

Receptor Information

>3ga6 Chain A (length=254) Species: 187420 (Methanothermobacter thermautotrophicus str. Delta H)

VLKIISWNVNGLRAVHRKGFLKWFMEEKPDILCLQEIKAAPEQLPRKLRH
VEGYRSFFTPAERKGYSGVAMYTKVPPSSLREGFGVERFDTEGRIQIADF
DDFLLYNIYFPNGKMSEERLKYKLEFYDAFLEDVNRERDSGRNVIICGNF
NTAHREIDLARPKENSNVSGFLPVERAWIDKFIENGYVDTFRMFNSDPGQ
YTWWSYRTRARERNVGWRLDYFFVNEEFKGKVKRSWILSDVMGSDHCPIG
LEIE

Ligand information

>3ga6 Chain F (length=11)

gctgcgcaggg

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3ga6 Crystal Structure Analysis of DNA Uridine Endonuclease Mth212 Bound to DNA
• Resolution: 1.898 Å
• Binding residue (original residue number in PDB): K1116 R1163 N1167 R1209 T1210 R1215 V1217 W1219
• Binding residue (residue number reindexed from 1): K114 R161 N165 R207 T208 R213 V215 W217

Enzymatic activity

• Catalytic site (original residue number in PDB): N1010 N1012 E1038 Y1111 N1151 N1153 D1222 D1247 H1248
• Catalytic site (residue number reindexed from 1): N8 N10 E36 Y109 N149 N151 D220 D245 H246
• Enzyme Commision number: 3.1.11.2: exodeoxyribonuclease III.
  4.2.99.18: DNA-(apurinic or apyrimidinic site) lyase.

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003824 catalytic activity
• GO:0003906 DNA-(apurinic or apyrimidinic site) endonuclease activity
• GO:0004518 nuclease activity
• GO:0004519 endonuclease activity
• GO:0008081 phosphoric diester hydrolase activity
• GO:0008311 double-stranded DNA 3'-5' DNA exonuclease activity
• GO:0016787 hydrolase activity
• GO:0016829 lyase activity
• GO:0046872 metal ion binding
• GO:0140078 class I DNA-(apurinic or apyrimidinic site) endonuclease activity

Biological Process

• GO:0006281 DNA repair
• GO:0006284 base-excision repair

External links

• PDB: RCSB:3ga6, PDBe:3ga6, PDBj:3ga6
• PDBsum: 3ga6
• PubMed: 20434457
• UniProt: O26314|UREND_METTH DNA uridine endonuclease (Gene Name=MTH_212)