Structure of PDB 3g9m Chain A Binding Site BS01

Receptor Information
>3g9m Chain A (length=78) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SHMCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDK
IRRKNCPACRYRKCLQAGMNLEARKTKK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3g9m DNA binding site sequence directs glucocorticoid receptor structure and activity.
Resolution1.61 Å
Binding residue
(original residue number in PDB)		S459 R466 R489 K490 R496
Binding residue
(residue number reindexed from 1)		S23 R30 R53 K54 R60
Binding affinityPDBbind-CN: Kd=0.15uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3g9m, PDBe:3g9m, PDBj:3g9m
PDBsum3g9m
PubMed19372434
UniProtP06536|GCR_RAT Glucocorticoid receptor (Gene Name=Nr3c1)

[Back to BioLiP]