Structure of PDB 3g8t Chain A Binding Site BS01

Receptor Information
>3g8t Chain A (length=90) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAF
VIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAK
Ligand information
>3g8t Chain P (length=141) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggcaccauugcacuccggugccaguugacgagaugggguuuaucgagauu
ucggcggaugacucccgguuguucaucacaaccgcaagcuuuuacuuaaa
ucauuaaggugacuuaguggacaaaggugaaagugugauga
<<<<<<..........>>>>>>......(((...<<<<<<..))).....
.........>>>>>><<<<<<..(((((>>>>>>...<<<<<<<<<<...
<<<<<<<<....>>>>>>>.>...>>>>>>>>>>.))))).
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3g8t Structural and chemical basis for glucosamine 6-phosphate binding and activation of the glmS ribozyme
Resolution3.0 Å
Binding residue
(original residue number in PDB)		Y13 N15 N16 E19 S48 L49 K50 M51 R52 Q54 F56 Q85 Y86 A87 K88 S91
Binding residue
(residue number reindexed from 1)		Y7 N9 N10 E13 S42 L43 K44 M45 R46 Q48 F50 Q79 Y80 A81 K82 S85
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:3g8t, PDBe:3g8t, PDBj:3g8t
PDBsum3g8t
PubMed19228039
UniProtP09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)

[Back to BioLiP]