Structure of PDB 3g8i Chain A Binding Site BS01

Receptor Information

>3g8i Chain A (length=254) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DLKSLAKRIYEAYLKNFNMNKVKARVILSPPFVIHDMETLCMAEKTLVAK
LKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVY
EAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMK
FNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQS
NHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIY
RDMY

Ligand information

>3g8i Chain Z (length=8) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

HQLLRYLL

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3g8i Aleglitazar, a new, potent, and balanced dual PPARalpha/gamma agonist for the treatment of type II diabetes.
Resolution	2.2 Å
Binding residue (original residue number in PDB)	T288 L302 N303 Q305 V306 L309 K310 P458 E462
Binding residue (residue number reindexed from 1)	T74 L88 N89 Q91 V92 L95 K96 P244 E248

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0004879	nuclear receptor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

	Cellular Component
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3g8i, PDBe:3g8i, PDBj:3g8i
PDBsum	3g8i
PubMed	19349176
UniProt	Q07869\|PPARA_HUMAN Peroxisome proliferator-activated receptor alpha (Gene Name=PPARA)

[Back to BioLiP]