Structure of PDB 3g0q Chain A Binding Site BS01

Receptor Information

>3g0q Chain A (length=344) Species: 1422 (Geobacillus stearothermophilus)

PAREFQRDLLDWFARERRDLPWRKDRDPYKVWVSEVMLQQTRVETVIPYF
EQFIDRFPTLEALADADEDEVLKAWEGLGYYSRVRNLHAAVKEVKTRYGG
KVPDDPDEFSRLKGVGPYTVGAVLSLAYGVPEPAVDGNVMRVLSRLFLVT
DDIAKCSTRKRFEQIVREIMAYENPGAFNEALIELGALVCTPRRPSCLLC
PVQAYCQAFAEGVAEELPVKMVKQVPLAVAVLADDEGRVLIRKRDSTGLL
ANLWEFPSCETDGADGKEKLEQMVGLQVELTEPIVSFEHAFSHLVWQLTV
FPGRLVHGGPVEEPYRLAPEDELKAYAFPVSHQRVWREYKEWAS

Ligand information

>3g0q Chain B (length=11)

aagacggggac

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3g0q Atomic substitution reveals the structural basis for substrate adenine recognition and removal by adenine DNA glycosylase.
• Resolution: 2.2 Å
• Binding residue (original residue number in PDB): Q48 R50 G85 L86 G87 Y88 Y89 R201 G260 L261 L262 H305 F307 S308 H309 P345 V346
• Binding residue (residue number reindexed from 1): Q40 R42 G77 L78 G79 Y80 Y81 R193 G248 L249 L250 H289 F291 S292 H293 P329 V330

Enzymatic activity

• Catalytic site (original residue number in PDB): E43 Y126 D144
• Catalytic site (residue number reindexed from 1): E35 Y118 D136
• Enzyme Commision number: 3.2.2.31: adenine glycosylase.

Gene Ontology

Molecular Function

• GO:0000701 purine-specific mismatch base pair DNA N-glycosylase activity
• GO:0003677 DNA binding
• GO:0003824 catalytic activity
• GO:0016798 hydrolase activity, acting on glycosyl bonds
• GO:0019104 DNA N-glycosylase activity
• GO:0032357 oxidized purine DNA binding
• GO:0034039 8-oxo-7,8-dihydroguanine DNA N-glycosylase activity
• GO:0035485 adenine/guanine mispair binding
• GO:0046872 metal ion binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0006281 DNA repair
• GO:0006284 base-excision repair
• GO:0006298 mismatch repair
• GO:0006950 response to stress

External links

• PDB: RCSB:3g0q, PDBe:3g0q, PDBj:3g0q
• PDBsum: 3g0q
• PubMed: 19841264
• UniProt: P83847|MUTY_GEOSE Adenine DNA glycosylase (Gene Name=mutY)