Structure of PDB 3fwv Chain A Binding Site BS01

Receptor Information
>3fwv Chain A (length=128) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYIVNQAAVYFE
KGDYNKCRELCEKAIEVGRENREDYRMIAYAYARIGNSYFKEEKYKDAIH
FYNKSLAEHRTPKVLKKCQQAEKILKEQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3fwv Redesign of a protein-peptide interaction: characterization and applications
Resolution2.2 Å
Binding residue
(original residue number in PDB)
K229 N233 Y236 T260 N264 F270 E271 Y301 R305 N308 K334
Binding residue
(residue number reindexed from 1)
K8 N12 Y15 T39 N43 F49 E50 Y80 R84 N87 K113
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3fwv, PDBe:3fwv, PDBj:3fwv
PDBsum3fwv
PubMed19309728
UniProtP31948|STIP1_HUMAN Stress-induced-phosphoprotein 1 (Gene Name=STIP1)

[Back to BioLiP]