Structure of PDB 3ftg Chain A Binding Site BS01

Receptor Information
>3ftg Chain A (length=247) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAP
WMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSG
CDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQS
GAAEHYKAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTRCWALGFYPA
DITLTWQLELVETRPAGDGTFQKWASQNYTCRVYHEGLPEPLTLRWE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3ftg Protective efficacy of cross-reactive CD8+ T cells recognising mutant viral epitopes depends on peptide-MHC-I structural interactions and T cell activation threshold.
Resolution2.6 Å
Binding residue
(original residue number in PDB)
Y7 E63 K66 Q70 W73 V76 S77 N80 Y84 Q97 F116 Y123 T143 K146 W147 H155 Y156 Y159 Y171
Binding residue
(residue number reindexed from 1)
Y7 E63 K66 Q70 W73 V76 S77 N80 Y84 Q97 F116 Y123 T143 K146 W147 H155 Y156 Y159 Y171
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3ftg, PDBe:3ftg, PDBj:3ftg
PDBsum3ftg
PubMed20711359
UniProtP01899|HA11_MOUSE H-2 class I histocompatibility antigen, D-B alpha chain (Gene Name=H2-D1)

[Back to BioLiP]