Structure of PDB 3fte Chain A Binding Site BS01

Receptor Information

>3fte Chain A (length=233) Species: 224324 (Aquifex aeolicus VF5)

VSEGVLKKIAEELNIEEGNTVVEVGGGTGNLTKVLLQHPLKKLYVIELDR
EMVENLKSIGDERLEVINEDASKFPFCSLGKELKVVGNLPYNVASLIIEN
TVYNKDCVPLAVFMVQKEVAEKLQGKKDTGWLSVFVRTFYDVNYVMTVPP
RFFVPPPKVQSAVIKLVKNEKFPVKDLKNYKKFLTKIFQNRRKVLRKKIP
EELLKEAGINPDARVEQLSLEDFFKLYRLIEDS

Ligand information

>3fte Chain D (length=22)

aaccguaggggaaccugcgguu

......................

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3fte Structural Basis for Binding of RNA and Cofactor by a KsgA Methyltransferase.
• Resolution: 3.0 Å
• Binding residue (original residue number in PDB): K171 K195
• Binding residue (residue number reindexed from 1): K158 K182

Enzymatic activity

• Catalytic site (original residue number in PDB): G38 E60 N101 Y104 F166
• Catalytic site (residue number reindexed from 1): G25 E47 N88 Y91 F153
• Enzyme Commision number: 2.1.1.182: 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase.

Gene Ontology

Molecular Function

• GO:0000179 rRNA (adenine-N6,N6-)-dimethyltransferase activity
• GO:0003723 RNA binding
• GO:0008168 methyltransferase activity
• GO:0016433 rRNA (adenine) methyltransferase activity
• GO:0052908 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase activity

Biological Process

• GO:0000154 rRNA modification
• GO:0006364 rRNA processing
• GO:0031167 rRNA methylation
• GO:0032259 methylation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:3fte, PDBe:3fte, PDBj:3fte
• PDBsum: 3fte
• PubMed: 19278652
• UniProt: O67680|RSMA_AQUAE Ribosomal RNA small subunit methyltransferase A (Gene Name=rsmA)