Structure of PDB 3fon Chain A Binding Site BS01

Receptor Information
>3fon Chain A (length=274) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSLRYFVTAVSRPGHGKPRYMEVGYVDDTEFVRFDSDAENPRYEPRTP
WMEQVEPEYWEGQTQIAKGNEQSSRVDLRTALRYYNQSAGGSHTIQRMRG
CEVGSDGRLLRGYQQVAYDGRDYIALNEDLKTWTAADMAALITKHKWEQA
GAAERDRAYLEGACVEWLRRYLELGNATLLRTDSPKAHVTHHSRPKDKVT
LRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVP
LGKEQNYTCHVYHEGLPEPLTLRW
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3fon Predominant occupation of the class I MHC molecule H-2Kwm7 with a single self-peptide suggests a mechanism for its diabetes-protective effect.
Resolution2.03 Å
Binding residue
(original residue number in PDB)		Y7 E24 Q63 I66 N70 D77 Y84 R97 R99 T143 K146 W147 A152 R155 Y159 W167 Y171
Binding residue
(residue number reindexed from 1)		Y7 E24 Q63 I66 N70 D77 Y84 R97 R99 T143 K146 W147 A152 R155 Y159 W167 Y171
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0002474 antigen processing and presentation of peptide antigen via MHC class I
Cellular Component
GO:0016020 membrane
GO:0030670 phagocytic vesicle membrane
GO:0042612 MHC class I protein complex
GO:0098553 lumenal side of endoplasmic reticulum membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3fon, PDBe:3fon, PDBj:3fon
PDBsum3fon
PubMed20093428
UniProtD2YW38

[Back to BioLiP]