Structure of PDB 3fg5 Chain A Binding Site BS01

Receptor Information

>3fg5 Chain A (length=121) Species: 97228 (Daboia russelii pulchella)

SLLEFGKMILEETGKLAIPSYSSYGCYCGWGGKGTPKDATDRCCFVHDCC
YGNLPDCNPKSDRYKYKRVNGAIVCEKGTSCENRICECDKAAAICFRQNL
NTYSKKYMLYPDFLCKGELKC

Ligand information

>3fg5 Chain C (length=5)

FLSYK

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3fg5 Crystal structure determination of a ternary complex of phospholipase A2 with a pentapeptide FLSYK and Ajmaline at 2.5 A resolution
• Resolution: 2.5 Å
• Binding residue (original residue number in PDB): L2 F5 G6 A18 I19 S23 G30 W31 C45 K69
• Binding residue (residue number reindexed from 1): L2 F5 G6 A17 I18 S22 G29 W30 C44 K60

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Wed Nov 27 02:44:03 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '3fg5', asym_id = 'A', bs = 'BS01', title = 'Crystal structure determination of a ternary com...ntapeptide FLSYK and Ajmaline at 2.5 A resolution'

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='3fg5', asym_id='A', bs='BS01', title='Crystal structure determination of a ternary com...ntapeptide FLSYK and Ajmaline at 2.5 A resolution')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0004623,0005509,0006644,0016042,0050482', uniprot = '', pdbid = '3fg5', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004623,0005509,0006644,0016042,0050482', uniprot='', pdbid='3fg5', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>