Structure of PDB 3fea Chain A Binding Site BS01

Receptor Information
>3fea Chain A (length=83) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVRPKLPLLKILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQHMVY
CGGDLLGELLGRQSFSVKDPSPLYDMLRKNLVT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3fea Crystal Structures of Human MdmX (HdmX) in Complex with p53 Peptide Analogues Reveal Surprising Conformational Changes
Resolution1.33 Å
Binding residue
(original residue number in PDB)		M53 L56 G57 I60 M61 Y66 Q71 H72 V92 L98
Binding residue
(residue number reindexed from 1)		M28 L31 G32 I35 M36 Y41 Q46 H47 V67 L73
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0043066 negative regulation of apoptotic process
GO:0051726 regulation of cell cycle
Cellular Component
GO:0005634 nucleus

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3fea, PDBe:3fea, PDBj:3fea
PDBsum3fea
PubMed19153082
UniProtO15151|MDM4_HUMAN Protein Mdm4 (Gene Name=MDM4)

[Back to BioLiP]