Structure of PDB 3fdt Chain A Binding Site BS01

Receptor Information
>3fdt Chain A (length=51) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFM
K
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3fdt Recognition and specificity determinants of the human cbx chromodomains.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		E2 E3 Y4 V5 V6 W25 H32 E36 N40 D42 C43 E45 L46
Binding residue
(residue number reindexed from 1)		E1 E2 Y3 V4 V5 W24 H31 E35 N39 D41 C42 E44 L45
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3fdt, PDBe:3fdt, PDBj:3fdt
PDBsum3fdt
PubMed21047797
UniProtP45973|CBX5_HUMAN Chromobox protein homolog 5 (Gene Name=CBX5)

[Back to BioLiP]