Structure of PDB 3fdl Chain A Binding Site BS01

Receptor Information
>3fdl Chain A (length=143) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPLGSMSQSNRELVVDFLSYKLSQKGYSWSQMAAVKQALREAGDEFELRY
RRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALC
VESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVEL
Ligand information
>3fdl Chain B (length=25) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MRPEIWIAQELRRIGDEFNAYYARR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3fdl High-Resolution Structural Characterization of a Helical alpha/beta-Peptide Foldamer Bound to the Anti-Apoptotic Protein Bcl-x(L)
Resolution1.78 Å
Binding residue
(original residue number in PDB)		E96 F97 Y101 L108 Q111 H113 S122 V126 E129 L130 N136 G138 R139
Binding residue
(residue number reindexed from 1)		E45 F46 Y50 L57 Q60 H62 S71 V75 E78 L79 N85 G87 R88
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:3fdl, PDBe:3fdl, PDBj:3fdl
PDBsum3fdl
PubMed19229915
UniProtQ07817|B2CL1_HUMAN Bcl-2-like protein 1 (Gene Name=BCL2L1)

[Back to BioLiP]