Structure of PDB 3fbd Chain A Binding Site BS01

Receptor Information
>3fbd Chain A (length=132) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SKRNKPGKATGKGKPVNNKWLNNAGKDLGSPVPDRIANKLRDKEFKSFQD
FRKKFWEEVSKDPELSKQFSRNNNDRMKVGKAPKTRTQDVSGKRTSFELH
HEKPISQNGGVYDMDNISVVTPKRHIDIHRGK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3fbd Redesign of high-affinity nonspecific nucleases with altered sequence preference
Resolution2.9 Å
Binding residue
(original residue number in PDB)		R447 R496 K525 A526 S540 E542 L543 H544 S550 H569 H573
Binding residue
(residue number reindexed from 1)		R3 R52 K81 A82 S96 E98 L99 H100 S106 H125 H129
Enzymatic activity
Catalytic site (original residue number in PDB) R447 R538 E542 H544 H545 H569 H573
Catalytic site (residue number reindexed from 1) R3 R94 E98 H100 H101 H125 H129
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
GO:0005102 signaling receptor binding
Biological Process
GO:0009617 response to bacterium
GO:0019835 cytolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3fbd, PDBe:3fbd, PDBj:3fbd
PDBsum3fbd
PubMed
UniProtQ47112|CEA7_ECOLX Colicin-E7 (Gene Name=colE7)

[Back to BioLiP]