Structure of PDB 3f9z Chain A Binding Site BS01

Receptor Information
>3f9z Chain A (length=156) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFV
VEFHGDLIEITDAKKREALYATGCYMYYFQYLSKTYCVDATRETNRLGRL
INHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEA
HPWLKH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3f9z Structural origins for the product specificity of SET domain protein methyltransferases.
Resolution1.6 Å
Binding residue
(original residue number in PDB)		F245 E259 Y262 A263 G269 C270 M272 Y273 Y274 T307 Y334 Y336 G337 D338 R339 S343 H347 W349
Binding residue
(residue number reindexed from 1)		F53 E67 Y70 A71 G73 C74 M76 Y77 Y78 T111 Y138 Y140 G141 D142 R143 S147 H151 W153
Enzymatic activity
Enzyme Commision number 2.1.1.-
2.1.1.361: [histone H4]-lysine(20) N-methyltransferase.
Gene Ontology
Molecular Function
GO:0042799 histone H4K20 methyltransferase activity

View graph for
Molecular Function
External links
PDB RCSB:3f9z, PDBe:3f9z, PDBj:3f9z
PDBsum3f9z
PubMed19088188
UniProtQ9NQR1|KMT5A_HUMAN N-lysine methyltransferase KMT5A (Gene Name=KMT5A)

[Back to BioLiP]