Structure of PDB 3f9w Chain A Binding Site BS01

Receptor Information
>3f9w Chain A (length=160) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFV
VEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNR
LGRLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLFDYGDRSKA
SIEAHPWLKH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3f9w Structural origins for the product specificity of SET domain protein methyltransferases.
Resolution1.6 Å
Binding residue
(original residue number in PDB)		Y245 E259 Y262 C270 M272 Y273 Y274 T307 Y336 G337 D338 R339 S343 H347 W349
Binding residue
(residue number reindexed from 1)		Y53 E67 Y70 C78 M80 Y81 Y82 T115 Y144 G145 D146 R147 S151 H155 W157
Enzymatic activity
Enzyme Commision number 2.1.1.-
2.1.1.361: [histone H4]-lysine(20) N-methyltransferase.
Gene Ontology
Molecular Function
GO:0042799 histone H4K20 methyltransferase activity

View graph for
Molecular Function
External links
PDB RCSB:3f9w, PDBe:3f9w, PDBj:3f9w
PDBsum3f9w
PubMed19088188
UniProtQ9NQR1|KMT5A_HUMAN N-lysine methyltransferase KMT5A (Gene Name=KMT5A)

[Back to BioLiP]