Structure of PDB 3f7d Chain A Binding Site BS01

Receptor Information

>3f7d Chain A (length=238) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PNVPELILQLLQLEPEEDQVRARIVGCLQEPAKSDQPAPFSLLCRMADQT
FISIVDWARRCMVFKELEVADQMTLLQNSWSELLVLDHIYRQVQYGKEDS
ILLVTGQEVELSTVAVQAGSLLHSLVLRAQELVLQLHALQLDRQEFVCLK
FLILFSLDVKFLNNHSLVKDAQEKANAALLDYTLSHYPHSGDKFQQLLLS
LVEVRALSMQAKEYLYHKHLGNEMPRNNLLIEMLQAKQ

Ligand information

>3f7d Chain B (length=10) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

PSLLKKLLLA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3f7d Structure of SF-1 bound by different phospholipids: evidence for regulatory ligands.
Resolution	2.2 Å
Binding residue (original residue number in PDB)	R282 M296 R449 N451 L452 E455
Binding residue (residue number reindexed from 1)	R59 M73 R226 N228 L229 E232

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0004879	nuclear receptor activity

View graph for
Molecular Function

External links

PDB	RCSB:3f7d, PDBe:3f7d, PDBj:3f7d
PDBsum	3f7d
PubMed	18988706
UniProt	P33242\|STF1_MOUSE Steroidogenic factor 1 (Gene Name=Nr5a1)

[Back to BioLiP]