Structure of PDB 3eyi Chain A Binding Site BS01

Receptor Information

>3eyi Chain A (length=64) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SPQFSQQREEDIYRFLKDNGPQRALVIAQALGMRTAKDVNRDLYRMKSRH
LLDMDEQSKAWTIY

Ligand information

>3eyi Chain C (length=6) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cgcgcg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3eyi The crystal structure of the second Z-DNA binding domain of human DAI (ZBP1) in complex with Z-DNA reveals an unusual binding mode to Z-DNA.
Resolution	1.45 Å
Binding residue (original residue number in PDB)	R124 K138 N141 R142 Y145
Binding residue (residue number reindexed from 1)	R23 K37 N40 R41 Y44

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003723	RNA binding
GO:0003726	double-stranded RNA adenosine deaminase activity

	Biological Process
GO:0060340	positive regulation of type I interferon-mediated signaling pathway

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:3eyi, PDBe:3eyi, PDBj:3eyi
PDBsum	3eyi
PubMed	19095800
UniProt	Q9H171\|ZBP1_HUMAN Z-DNA-binding protein 1 (Gene Name=ZBP1)

[Back to BioLiP]