Structure of PDB 3ey1 Chain A Binding Site BS01

Receptor Information
>3ey1 Chain A (length=137) Species: 86665 (Halalkalibacterium halodurans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKEEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMG
EFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALI
WKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYGR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3ey1 A conformational transition in the structure of a 2'-thiomethyl-modified DNA visualized at high resolution.
Resolution1.6 Å
Binding residue
(original residue number in PDB)		D71 V72 G73 N132 T183 D192 G194
Binding residue
(residue number reindexed from 1)		D13 V14 G15 N74 T125 D134 G136
Enzymatic activity
Enzyme Commision number 3.1.26.4: ribonuclease H.
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0004523 RNA-DNA hybrid ribonuclease activity

View graph for
Molecular Function
External links
PDB RCSB:3ey1, PDBe:3ey1, PDBj:3ey1
PDBsum3ey1
PubMed19333476
UniProtQ9KEI9|RNH1_HALH5 Ribonuclease H (Gene Name=rnhA)

[Back to BioLiP]