Structure of PDB 3exb Chain A Binding Site BS01

Receptor Information
>3exb Chain A (length=289) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LVHVASVEKGRSYEDFQKVYNAIALKLREDDEYDNYIGYGPVLVRLAWHI
SGTWDKHDNTGGSYGGTYRFKKEFNDPSNAGLQNGFKFLEPIHKEFPWIS
SGDLFSLGGVTAVQEMQGPKIPWRCGRVDTPEDTTPDNGRLPDADKDAGY
VRTFFQRLNMNDREVVALMGAHALGKTHLKNSGYEGGGANNVFTNEFYLN
LLNEDWKLEKNDANNEQWDSKSGYMMLPTDYSLIQDPKYLSIVKEYANDQ
DKFFKDFSKAFEKLLENGITFPKDAPSPFIFKTLEEQGL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3exb Replacement of an electron transfer pathway in cytochrome c peroxidase with a surrogate peptide
Resolution1.6 Å
Binding residue
(original residue number in PDB)		H175 L177 K179 G191 A192 N193 Y227 M228 D233
Binding residue
(residue number reindexed from 1)		H172 L174 K176 G188 A189 N190 Y224 M225 D230
Enzymatic activity
Catalytic site (original residue number in PDB) R48 H52 H175 D233
Catalytic site (residue number reindexed from 1) R45 H49 H172 D230
Enzyme Commision number 1.11.1.5: cytochrome-c peroxidase.
Gene Ontology
Molecular Function
GO:0004601 peroxidase activity
GO:0020037 heme binding
Biological Process
GO:0006979 response to oxidative stress
GO:0034599 cellular response to oxidative stress

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3exb, PDBe:3exb, PDBj:3exb
PDBsum3exb
PubMed19072042
UniProtP00431|CCPR_YEAST Cytochrome c peroxidase, mitochondrial (Gene Name=CCP1)

[Back to BioLiP]