Structure of PDB 3et1 Chain A Binding Site BS01

Receptor Information

>3et1 Chain A (length=263) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ETADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLC
MAEKTLVAQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQ
VTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIM
EPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIV
HVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAA
LHPLLQEIYRDMY

Ligand information

>3et1 Chain P (length=15) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

SLTERHKILHRLLQE

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3et1 Scaffold-based discovery of indeglitazar, a PPAR pan-active anti-diabetic agent
Resolution	2.5 Å
Binding residue (original residue number in PDB)	K292 L302 N303 Q305 L309 K310 P458 L459 E462 R465
Binding residue (residue number reindexed from 1)	K87 L97 N98 Q100 L104 K105 P253 L254 E257 R260

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0004879	nuclear receptor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

	Cellular Component
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3et1, PDBe:3et1, PDBj:3et1
PDBsum	3et1
PubMed	19116277
UniProt	Q07869\|PPARA_HUMAN Peroxisome proliferator-activated receptor alpha (Gene Name=PPARA)

[Back to BioLiP]