Structure of PDB 3esk Chain A Binding Site BS01

Receptor Information
>3esk Chain A (length=128) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFE
KGDYNKCRELCEKAIEVGRENREDYRQIAKAYARIGNSYFKEEKYKDAIH
FYNKSLAEHRTPDVLKKCQQAEKILKEQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3esk Electrostatic interactions of Hsp-organizing protein tetratricopeptide domains with Hsp70 and Hsp90: computational analysis and protein engineering.
Resolution2.05 Å
Binding residue
(original residue number in PDB)
K229 N233 Y236 N264 F270 E271 Q298 K301 R305 N308
Binding residue
(residue number reindexed from 1)
K8 N12 Y15 N43 F49 E50 Q77 K80 R84 N87
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3esk, PDBe:3esk, PDBj:3esk
PDBsum3esk
PubMed19586912
UniProtP31948|STIP1_HUMAN Stress-induced-phosphoprotein 1 (Gene Name=STIP1)

[Back to BioLiP]