Structure of PDB 3epk Chain A Binding Site BS01

Receptor Information
>3epk Chain A (length=402) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SKKVIVIAGTTGVGKSQLSIQLAQKFNGEVINSDSMQVYKDIPIITNKHP
LQEREGIPHHVMNHVDWSEEYYSHRFETECMNAIEDIHRRGKIPIVVGGT
HYYLQTLFNKRVDTKSSERKLTRKQLDILESTDPDVIYNTLVKCDPDIAT
KYHPNDYRRVQRMLEIYYKTGKKPSETFNEQKITLKFDTLFLWLYSKPEP
LFQRLDDRVDDMLERGALQEIKQLYEYYSQNKFTPEQCENGVWQVIGFKE
FLPWLTVKLEDCIERMKTRTRQYAKRQVKWIKKMLIPDIKGDIYLLDATD
LSQWDTNASQRAIAISNDFISNRPIKQERAPKALEELLSKGETTMKKLDD
WTHYTCNVCRNADGKNVVAIGEKYWKIHLGSRRHKSNLKRNTRQADFEKW
KI
Ligand information
>3epk Chain E (length=69) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cucguauggcgcagugguagcgcagcagauugcaaaucuguugguccuua
guucgauccugagugcgag
<<<<<...<<<<.......>>>>.<<<<<<.....>>>>>>.....<<<<
<.......>>>>>.>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3epk Crystallographic snapshots of eukaryotic dimethylallyltransferase acting on tRNA: insight into tRNA recognition and reaction mechanism.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		D46 S47 M48 T58 Y84 T112 Y114 Y115 K122 R123 V124 T126 Y164 H165 N167 D168 R170 R171 R174 F190 Q193 E251 Q256 V257 I258 K261 R288 Q291 Y292 K294 K298 W299 K302 M303 K366 L367 N380 Y393 H397 S400 R401 R402 S405 R412
Binding residue
(residue number reindexed from 1)		D34 S35 M36 T46 Y72 T100 Y102 Y103 K110 R111 V112 T114 Y152 H153 N155 D156 R158 R159 R162 F178 Q181 E239 Q244 V245 I246 K249 R269 Q272 Y273 K275 K279 W280 K283 M284 K347 L348 N361 Y374 H378 S381 R382 R383 S386 R393
Enzymatic activity
Enzyme Commision number 2.5.1.75: tRNA dimethylallyltransferase.
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0005524 ATP binding
GO:0008270 zinc ion binding
GO:0016740 transferase activity
GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups
GO:0046872 metal ion binding
GO:0052381 tRNA dimethylallyltransferase activity
Biological Process
GO:0006400 tRNA modification
GO:0008033 tRNA processing
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3epk, PDBe:3epk, PDBj:3epk
PDBsum3epk
PubMed18852462
UniProtP07884|MOD5_YEAST tRNA dimethylallyltransferase (Gene Name=MOD5)

[Back to BioLiP]