Structure of PDB 3emw Chain A Binding Site BS01

Receptor Information

>3emw Chain A (length=200) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

LYFQSMPEGLEELLSAPPPDLGAQRRHGWNPKDCSENIEVKEGGLYFERR
PVAQSTDGARGKRGYSRGLHAWEISWPLEQRGTHAVVGVATALAPLQTDH
YAALLGSNSESWGWDIGRGKLYHQSKGPGAPQYPAGTQGEQLEVPERLLV
VLDMEEGTLGYAIGGTYLGPAFRGLKGRTLYPAVSAVWGQCQVRIRYLGE

Ligand information

>3emw Chain B (length=7) Species: 7227 (Drosophila melanogaster) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

DINNNNN

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3emw Structural basis for Par-4 recognition by the SPRY domain- and SOCS box-containing proteins SPSB1, SPSB2, and SPSB4.
Resolution	1.8 Å
Binding residue (original residue number in PDB)	R68 P70 V71 A72 G101 T102 Y120 V206 W207 G208
Binding residue (residue number reindexed from 1)	R49 P51 V52 A53 G82 T83 Y101 V187 W188 G189

Enzymatic activity

Enzyme Commision number

External links

PDB	RCSB:3emw, PDBe:3emw, PDBj:3emw
PDBsum	3emw
PubMed	20561531
UniProt	Q99619\|SPSB2_HUMAN SPRY domain-containing SOCS box protein 2 (Gene Name=SPSB2)

[Back to BioLiP]