Structure of PDB 3egz Chain A Binding Site BS01

Receptor Information
>3egz Chain A (length=91) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQA
FVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAK
Ligand information
>3egz Chain B (length=65) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gagggagaggugaagaauacgaccaccuagguaccauugcacuccgguac
cuaaaacauacccuc
<<<<<...<<<<...........>>>><<<<<<<<..........>>>>>
>>>.......>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3egz Structural basis for specific, high-affinity tetracycline binding by an in vitro evolved aptamer and artificial riboswitch
Resolution2.2 Å
Binding residue
(original residue number in PDB)		Y208 N210 N211 E214 K217 S243 L244 K245 M246 R247 Q249 F251 K275 R278 Q280 K283 D285 S286 D287
Binding residue
(residue number reindexed from 1)		Y8 N10 N11 E14 K17 S43 L44 K45 M46 R47 Q49 F51 K75 R78 Q80 K83 D85 S86 D87
Binding affinityPDBbind-CN: Kd=0.6nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:3egz, PDBe:3egz, PDBj:3egz
PDBsum3egz
PubMed18940672
UniProtP09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)

[Back to BioLiP]