Structure of PDB 3eg1 Chain A Binding Site BS01

Receptor Information
>3eg1 Chain A (length=58) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPS
QYITPVNS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3eg1 Role of interfacial water molecules in proline-rich ligand recognition by the Src homology 3 domain of Abl.
Resolution1.85 Å
Binding residue
(original residue number in PDB)
Y70 D77 N94 E98 W99 W110 P112 Y115
Binding residue
(residue number reindexed from 1)
Y7 D14 N31 E35 W36 W47 P49 Y52
Enzymatic activity
Enzyme Commision number 2.7.10.2: non-specific protein-tyrosine kinase.
External links
PDB RCSB:3eg1, PDBe:3eg1, PDBj:3eg1
PDBsum3eg1
PubMed19906645
UniProtP00519|ABL1_HUMAN Tyrosine-protein kinase ABL1 (Gene Name=ABL1)

[Back to BioLiP]